Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus kodakaraensis UPF0290 protein TK2119(TK2119)

Recombinant Pyrococcus kodakaraensis UPF0290 protein TK2119(TK2119)

SKU:CSB-CF708447FHY

Regular price $1,767.00 USD
Regular price Sale price $1,767.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1))

Uniprot NO.:Q5JEX0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGWLSSIFWAFWYILPAYFANASPVLVGGGRPIDGGRVWRDGRRLLGDGKTWRGFIGGVL IGTLVGIVQYFITPDFYGSLETAVKLAFLLSFGALIGDLVGSFIKRRANLPRGYPAIGLD QLGFLISALAFAYPVKTLSSGQIIFLLVVSPFIHWGANYFAYRMGWKSVPW

Protein Names:Recommended name: UPF0290 protein TK2119

Gene Names:Ordered Locus Names:TK2119

Expression Region:1-171

Sequence Info:full length protein

View full details