Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus horikoshii UPF0056 membrane protein PH0214 (PH0214)

Recombinant Pyrococcus horikoshii UPF0056 membrane protein PH0214 (PH0214)

SKU:CSB-CF530031FHX

Regular price $1,876.00 USD
Regular price Sale price $1,876.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Uniprot NO.:O57953

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEILSSALLMLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANLIGFILLLLFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALEGGGMVTIKREKNILALAAVPVATPLIAGP AAITAAITLTAEHGIIVSIVGTLIAIAITAALMMIALYLMRGISKTALSVTIRIIGLFIM AIGAQMMITGAGGIVLNLIKGA

Protein Names:Recommended name: UPF0056 membrane protein PH0214

Gene Names:Ordered Locus Names:PH0214 ORF Names:PHBW009

Expression Region:1-202

Sequence Info:full length protein

View full details