Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus abyssi UPF0290 protein PYRAB16220(PYRAB16220)

Recombinant Pyrococcus abyssi UPF0290 protein PYRAB16220(PYRAB16220)

SKU:CSB-CF891696FHV

Regular price $1,765.00 USD
Regular price Sale price $1,765.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrococcus abyssi (strain GE5 / Orsay)

Uniprot NO.:Q9UY86

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPIFEAFWYILPAYFANSSPVVLGGGTPIDFGKKWRDGRRIFGDGKTWRGFFGGITVGT VVGTIQHLMFPGYYGSLKLAVGVAFLLSLGALVGDLIGSFIKRRLNMPRGYPAVGLDQWG FLISALCFAYPLRTIPTGEVLFLLVVTPVIHWLANVFAYRMKWKNVPW

Protein Names:Recommended name: UPF0290 protein PYRAB16220

Gene Names:Ordered Locus Names:PYRAB16220 ORF Names:PAB1285

Expression Region:1-168

Sequence Info:full length protein

View full details