Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_0007(Pcryo_0007)

Recombinant Psychrobacter cryohalolentis UPF0059 membrane protein Pcryo_0007(Pcryo_0007)

SKU:CSB-CF629942PAAM

Regular price $1,872.00 USD
Regular price Sale price $1,872.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Psychrobacter cryohalolentis (strain K5)

Uniprot NO.:Q1QEW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIG YLLGAVLLGWLATAAPWLGGGILILLGAKMLYEAFNGEIEAVLEDSFDRNMQEKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACSIIAIVTAGFGFFGIYLGKSSGTWLEDKAEI LGGLVLIAIGIKVMFIR

Protein Names:Recommended name: UPF0059 membrane protein Pcryo_0007

Gene Names:Ordered Locus Names:Pcryo_0007

Expression Region:1-197

Sequence Info:full length protein

View full details