Recombinant Psychrobacter arcticus  NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit A(nuoA)

CSB-CF676803PAAV
Regular price
$1,171.00 USD
Sale price
$1,171.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Psychrobacter arcticus (strain DSM 17307 / 273-4)

Uniprot NO.:Q4FU64

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAFNWSAIAFILAAIALVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKF YLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPA DKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQ NIDHINTTGNVTSVDFATSAQTDNIKR

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:Psyc_0584

Expression Region:1-207

Sequence Info:full length protein