Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psittacid herpesvirus 1 Glycoprotein N(UL49.5)

Recombinant Psittacid herpesvirus 1 Glycoprotein N(UL49.5)

SKU:CSB-CF764923PAAF

Regular price $1,668.00 USD
Regular price Sale price $1,668.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)

Uniprot NO.:Q6UDL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AQLDAGILNPWGSAGHNDAVMPGMFANSESDERFYSPHCSSRGLPLVNESMASVIFFLSL AMVCVAIVAILYNCCFNSFKNSVINSRW

Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein UL49.5 Protein UL49A

Gene Names:Name:UL49.5

Expression Region:28-115

Sequence Info:full length protein

View full details