
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas syringae pv. syringae (strain B728a)
Uniprot NO.:P95577
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIL AACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEGQKPAAVPADVP QAPEKK
Protein Names:Recommended name: Protein-export membrane protein SecG
Gene Names:Name:secG Ordered Locus Names:Psyr_4183
Expression Region:1-126
Sequence Info:full length protein