GeneBio Systems
Recombinant Pseudomonas putida 2-hydroxymuconate semialdehyde hydrolase (xylF)
Recombinant Pseudomonas putida 2-hydroxymuconate semialdehyde hydrolase (xylF)
SKU:P23106
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P23106
Gene Names: xylF
Alternative Name(s): (HMSH)(2-hydroxymuconic semialdehyde hydrolase)
Abbreviation: Recombinant Pseudomonas putida xylF protein
Organism: Pseudomonas putida (Arthrobacter siderocapsulatus)
Source: E.coli
Expression Region: 1-281aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MNAPQQSPEIGREILAAGYRTNLHDQGEGFPALLIHGSGPASPPGPTGAGSFRSSQTRRVIAPDMLGFGYSERPADGKYSQARWVEHAIGVLDALGIQQGDIVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFPITAGLETAWGYTPSLANMRRLLDLFAHDRTLVNDELAELRYQASIRPGFQESFAAMFPPPRQNGVDDLASNETDIRALPNETLVIHGREDRIIPLQASLTLAQWIPNAQLHVFGQCGHWTQIEHAERFARLVENFLAEADALHS
MW: 38.0 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20ā/-80ā. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20ā/-80ā. The shelf life of lyophilized form is 12 months at -20ā/-80ā.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
Relevance: Catalyzes the conversion of 2-hydroxymuconate semialdehyde to 2-hydroxypent-2,4-dienoate.
Reference: "Purification and some properties of the 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (2-hydroxymuconic semialdehyde hydrolase) encoded by the TOL plasmid pWW0 from Pseudomonas putida mt-2." Duggleby C.J., Williams P.A. J. Gen. Microbiol. 132: 2459-2474(1991)
Function:
