Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens UPF0060 membrane protein PFL_4337(PFL_4337)

Recombinant Pseudomonas fluorescens UPF0060 membrane protein PFL_4337(PFL_4337)

SKU:CSB-CF679328PAAW

Regular price $1,692.00 USD
Regular price Sale price $1,692.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Uniprot NO.:Q4K8K4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNYLWFFLAALFEIAGCYAFWMWLRQGKSALWVIPALVSLTLFALLLTKVEATYAGRAY AAYGGIYIVASIGWLAVVERVRPLGSDWLGLALCVIGASVILFGPRFSNG

Protein Names:Recommended name: UPF0060 membrane protein PFL_4337

Gene Names:Ordered Locus Names:PFL_4337

Expression Region:1-110

Sequence Info:full length protein

View full details