Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens UPF0059 membrane protein PFL_2642(PFL_2642)

Recombinant Pseudomonas fluorescens UPF0059 membrane protein PFL_2642(PFL_2642)

SKU:CSB-CF678740PAAW

Regular price $1,860.00 USD
Regular price Sale price $1,860.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Uniprot NO.:Q4KDD4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPASIIFLAFAMSTDAFAAAVGKGSAMLKPRLLEALRIGLIFGVIEAITPVVGWFIGQA ATQWVANWDHWIAFSLLLLLGLHMIYNGTRQQAEAEEEKPRQHGFWLLAVTGLATSIDAL AVGVGLAFVNVNIWVAASAIGLATMTMVTLGVMLGRAIGTVMGQRAEVLGGVVLIIVGSR ILYEHLSAVA

Protein Names:Recommended name: UPF0059 membrane protein PFL_2642

Gene Names:Ordered Locus Names:PFL_2642

Expression Region:1-190

Sequence Info:full length protein

View full details