Gene Bio Systems
Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1(dsbB1)
Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1(dsbB1)
SKU:CSB-CF659368PAAQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas fluorescens (strain Pf0-1)
Uniprot NO.:Q3K767
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEETIRLGRERRYLVLLGIICLALIGGALYMQIVLGEAPCPLCILQRYALLLIALFAFI GAAMRTRRSITVFEVLVVICAIAGAGVAGHHVYTQFYPAVSCGIDVLQPIVDDLPLAKIF PLGFQVDGFCSTPYPPILGLSLAQWALVAFVLVVILVPLLTSRNRKALR
Protein Names:Recommended name: Disulfide bond formation protein B 1 Alternative name(s): Disulfide oxidoreductase 1
Gene Names:Name:dsbB1 Ordered Locus Names:Pfl01_4650
Expression Region:1-169
Sequence Info:full length protein
