Skip to product information
1 of 1

GeneBio Systems

Recombinant Pseudomonas aeruginosa Type III needle protein PscF (pscF)

Recombinant Pseudomonas aeruginosa Type III needle protein PscF (pscF)

SKU:P95434

Regular price $1,068.00 USD
Regular price Sale price $1,068.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P95434

Gene Names: pscF

Alternative Name(s): Pseudomonas secretion protein F

Abbreviation: Recombinant Pseudomonas aeruginosa pscF protein

Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Source: E.coli

Expression Region: 2-85aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI

MW: 16.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

Reference: "Structure of the heterotrimeric complex that regulates type III secretion needle formation." Quinaud M., Ple S., Job V., Contreras-Martel C., Simorre J.P., Attree I., Dessen A. Proc. Natl. Acad. Sci. U.S.A. 104: 7803-7808(2007)

Function: Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

View full details