Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)

Recombinant Pseudomonas aeruginosa Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)

SKU:CSB-CF411923PZL

Regular price $1,726.00 USD
Regular price Sale price $1,726.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain PA7)

Uniprot NO.:A6V1N6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVPRGWLAALGSVLLVSAAQLGMRWGMSRLPLPEAWAGQTPEHAALLAVALAVAAYAAS LLCWLAALRHLPLGRAYSLLSASYALVYLLAASLPAFEETFTTGKTLGVGLVVLGVLTVN ARRTAAAPAHHPSRKAL

Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF

Gene Names:Name:arnF Ordered Locus Names:PSPA7_1587

Expression Region:1-137

Sequence Info:full length protein

View full details