Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfG(rnfG)

Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfG(rnfG)

SKU:CSB-CF483945EZY

Regular price $1,862.00 USD
Regular price Sale price $1,862.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain LESB58)

Uniprot NO.:B7UVW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAATRRSMLRNALLLGLFALVGVGLVALVQQFTEARIAEAQREARGRALLELLPPGSYD NHPLDSQVPTFAPKLLGLDAPRPAYVARLHGQASAVILQASAPDGYSGAIQLLVGVTAQG RLLGVRVVAHKETPGLGDRIELAKSPWVHGFDGKSLGDPADAGWAVKKDGGTFDQFAGAT VTPRAVVRAVHKALRYFDANRERLLAPEEAAGHE

Protein Names:Recommended name: Electron transport complex protein RnfG

Gene Names:Name:rnfG Ordered Locus Names:PLES_15221

Expression Region:1-214

Sequence Info:full length protein

View full details