Gene Bio Systems
Recombinant Pseudomonas aeruginosa Cytochrome o ubiquinol oxidase subunit 3(cyoC)
Recombinant Pseudomonas aeruginosa Cytochrome o ubiquinol oxidase subunit 3(cyoC)
SKU:CSB-CF884816EZX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Uniprot NO.:Q9I425
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTAVLNKHLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTA GGPSGKDIFELPYVLVETAILLVSSCTYGLAMLSAHKGAKGQAIAWLGVTFLLGAAFIGM EINEFHHLIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNT RMMCLSLFWHFLDIVWICVFTVVYLMGAL
Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III
Gene Names:Name:cyoC Ordered Locus Names:PA1319
Expression Region:1-209
Sequence Info:full length protein
