Gene Bio Systems
Recombinant Protein CrcB homolog 3(crcB3)
Recombinant Protein CrcB homolog 3(crcB3)
SKU:CSB-CF845690YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8ZDB1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAIDVMWVGLGGGIGSLLRWWIGLSIGKVYKGNFPLGTFLINISGAFVIGYLSILFSVD WRDRYGDLMNTAVLTGILGGYTTFSSMQLDAAKLATARGRAIAAGYLIISVLVGLAAAAF GAWLAY
Protein Names:Recommended name: Protein CrcB homolog 3
Gene Names:Name:crcB3 Ordered Locus Names:YPO2677, y1249, YP_2478
Expression Region:1-126
Sequence Info:full length protein
