Skip to product information
1 of 1

Gene Bio Systems

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1(crcB1)

Recombinant Prochlorococcus marinus subsp. pastoris Protein CrcB homolog 1(crcB1)

SKU:CSB-CF746032EYQ

Regular price $1,538.00 USD
Regular price Sale price $1,538.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Uniprot NO.:Q7UZM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKKYLLTFLLTAYCATFLRFYFKNNFVISIIGSFLYGFFISRKISKSKKEILFSGFFAC FTSFSGFVHFLYQFIIQGYYLKLFIYLNVIVILNLIIMYIGFQLSRKIT

Protein Names:Recommended name: Protein CrcB homolog 1

Gene Names:Name:crcB1 Ordered Locus Names:PMM1631

Expression Region:1-109

Sequence Info:full length protein

View full details