Gene Bio Systems
Recombinant Probable ubiquinone biosynthesis protein UbiB(ubiB)
Recombinant Probable ubiquinone biosynthesis protein UbiB(ubiB)
SKU:CSB-CF674877DPU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Azotobacter chroococcum mcd 1
Uniprot NO.:Q43924
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EFEAAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGR QLYPELDLWTTAKPFLERWMRKRMSPKAMLDNLQGQLEQLPHLAQMTRAALEGMARPAHG APPPRDRHILRLLGAALLAGGVLLASRAPLNVADAWPGWLMLASGLYLLVRRQRFPD
Protein Names:Recommended name: Probable ubiquinone biosynthesis protein UbiB
Gene Names:Name:ubiB
Expression Region:1-177
Sequence Info:full length protein
