Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable protein-export membrane protein SecG(secG)

Recombinant Probable protein-export membrane protein SecG(secG)

SKU:CSB-CF336447MVN

Regular price $1,499.00 USD
Regular price Sale price $1,499.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:P38388

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT GIWLVSIIGVALLTKYR

Protein Names:Recommended name: Probable protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:ML0577 ORF Names:B1496_C3_206

Expression Region:1-77

Sequence Info:full length protein

View full details