Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hupC)

Recombinant Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hupC)

SKU:CSB-CF335312RKR

Regular price $1,896.00 USD
Regular price Sale price $1,896.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. viciae

Uniprot NO.:P27648

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIHETLAADAHGEKAIERQSVYVYEAPVRIWHWINAFSILTLALTGYFIGSPLPSVPGE ASANFLMGYIRFIHFAAGQLLAVFLILRVYWAFVGNVHARQIFYVPFWSGRFWKEWLHEV GWYTFLVRQPKKYVGHNPLPQFTMFLMFTLPLLFMAITGFALYSEGAGRDSWEYSLFGWV FSIWPNSQDIHTYHHLGMWVILVFVMVHIYVAVREDIMSRQSIISSMISGERLFKDRED

Protein Names:Recommended name: Probable Ni/Fe-hydrogenase B-type cytochrome subunit

Gene Names:Name:hupC

Expression Region:1-239

Sequence Info:full length protein

View full details