Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable membrane protein Rv1733c-MT1774 (Rv1733c, MT1774)

Recombinant Probable membrane protein Rv1733c-MT1774 (Rv1733c, MT1774)

SKU:CSB-CF303269MVZ

Regular price $1,816.00 USD
Regular price Sale price $1,816.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P71991

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVVMLLAVTVSLLTIPFA AAAGTAVQDSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKITVPARWVVN GIERSGEVNAKPGTKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAG ALLALTRAILIRVRNASWQHDIDSLFCTQR

Protein Names:Recommended name: Probable membrane protein Rv1733c/MT1774

Gene Names:Ordered Locus Names:Rv1733c, MT1774

Expression Region:1-210

Sequence Info:full length protein

View full details