
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Potato virus X (PVX)
Uniprot NO.:P0C787
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAQGHRLTAPVNSEKVYIVLGLSFALVSITFLLSRNSLPHVGDNIHSLPHGGAYRDGTK AILYNSPNLGSRVSLHNGKNAAFAAVLLLTLLIYGSKYISQRNHTCACGNNHSSH
Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 12 kDa protein Triple gene block 2 protein Short name= TGBp2
Gene Names:ORF Names:ORF3
Expression Region:1-115
Sequence Info:full length protein