Skip to product information
1 of 1

Gene Bio Systems

Recombinant Potato leafroll virus Major capsid protein (ORF3)

Recombinant Potato leafroll virus Major capsid protein (ORF3)

SKU:CSB-EP325916PQU

Regular price $1,243.00 USD
Regular price Sale price $1,243.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P17521

Gene Names: ORF3

Organism: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV)

AA Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK

Expression Region: 1-208aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 27.2 kDa

Alternative Name(s): Coat protein Short name: CP

Relevance: Major capsid protein.

Reference: "Identification and characterization of the potato leafroll virus putative coat protein gene."Kawchuk L.M., Martin R.R., Rochon D.M., McPherson J.J. Gen. Virol. 70:783-788(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details