Skip to product information
1 of 1

Gene Bio Systems

Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol(DODA)

Recombinant Portulaca grandiflora 4,5-DOPA dioxygenase extradiol(DODA)

SKU:CSB-EP767105PIAD

Regular price $1,132.00 USD
Regular price Sale price $1,132.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: DODA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Portulaca grandiflora (Rose moss)

Delivery time: 3-7 business days

Uniprot ID: Q7XA48

AA Sequence: MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-271aa

Protein length: Full Length

MW: 49.9 kDa

Alternative Name(s):

Relevance: Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.

Reference: "Characterization and functional identification of a novel plant 4,5-extradiol dioxygenase involved in betalain pigment biosynthesis in Portulaca grandiflora." Christinet L., Burdet F.X., Zaiko M., Hinz U.G., Zryd J.-P. Plant Physiol. 134:265-274(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details