Skip to product information
1 of 1

Gene Bio Systems

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5(GP5)

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5(GP5)

SKU:CSB-CF367569PYZ

Regular price $1,764.00 USD
Regular price Sale price $1,764.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Uniprot NO.:A0MD34

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DGNGNNSTYQYIYNLTICELNGTNWLSGHFEWAVETFVLYPVVTHILSLGFLTTSHFFDA LGLGAVSTAGFVGGRYVLSSVYGACAFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRG GVHRWKSPIVVEKLGKAEIGGNLVTIKHVVLEGVKAQPLTRTSAEQWEA

Protein Names:Recommended name: Glycoprotein 5 Short name= Protein GP5 Alternative name(s): G(L)

Gene Names:Name:GP5 ORF Names:5

Expression Region:33-201

Sequence Info:full length protein

View full details