Skip to product information
1 of 1

Gene Bio Systems

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4(GP4)

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4(GP4)

SKU:CSB-CF368832PYZ

Regular price $1,756.00 USD
Regular price Sale price $1,756.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Uniprot NO.:A0MD33

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CKPCFSTHLSDIKTNTTAAAGFMVLQNINCSRPHEASATQGQVPSRKSSQCREAVGVPQY ITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHV TQHTQQHHLVINHIRLLHFLTPSAMRWATTIACLFAILLAI

Protein Names:Recommended name: Glycoprotein 4 Short name= Protein GP4

Gene Names:Name:GP4 ORF Names:4

Expression Region:23-183

Sequence Info:full length protein

View full details