Gene Bio Systems
Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein(GP2b)
Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein(GP2b)
SKU:CSB-CF370643PYZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)
Uniprot NO.:A0MD31
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GSLWSKISQLFVDAFTEFLVSVVDIVIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAI HSPELSKVL
Protein Names:Recommended name: Envelope small membrane protein Short name= Protein E Alternative name(s): Glycoprotein 2b Short name= Protein GP2b Gs
Gene Names:Name:GP2b ORF Names:2b
Expression Region:2-70
Sequence Info:full length protein
