Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo pygmaeus (Bornean orangutan)
Uniprot NO.:Q0MQF7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYLGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKRENYLYAVRDREMFGYMKLHPEEFPEEEKKTYGEIFEKFHPVH
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b
Gene Names:Name:NDUFC2
Expression Region:1-119
Sequence Info:full length protein