Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8)

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial(NDUFB8)

SKU:CSB-CF315983EXP

Regular price $1,752.00 USD
Regular price Sale price $1,752.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo pygmaeus (Bornean orangutan)

Uniprot NO.:P0CB86

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPDLRLNWGEPMHWHLDMFNRNRVDTSPIPVSWNVMCMQLFGFLAFMIFMCWVGE VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial Alternative name(s): Complex I-ASHI Short name= CI-ASHI NADH-ubiquinone oxidoreductase ASHI subunit

Gene Names:Name:NDUFB8

Expression Region:29-186

Sequence Info:full length protein

View full details