![Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4(NDUFB4)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_d36d0059-8226-42f6-992f-6dd0130af027_{width}x.jpg?v=1659246322)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo pygmaeus (Bornean orangutan)
Uniprot NO.:P0CB71
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SFPKYKPSRLSPLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTTNVYPNFRPTPKNSLMGALYGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFQLSY
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 Alternative name(s): Complex I-B15 Short name= CI-B15 NADH-ubiquinone oxidoreductase B15 subunit
Gene Names:Name:NDUFB4
Expression Region:2-129
Sequence Info:full length protein