Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pongo abelii Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)

Recombinant Pongo abelii Phosphatidylinositol N-acetylglucosaminyltransferase subunit P(PIGP)

SKU:CSB-CF732688PYX

Regular price $1,722.00 USD
Regular price Sale price $1,722.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5R946

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPV YLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYARNQRQKKYQEEAIPALRDISISEVN QMFFLAAKELYTEN

Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit P EC= 2.4.1.198 Alternative name(s): Phosphatidylinositol-glycan biosynthesis class P protein Short name= PIG-P

Gene Names:Name:PIGP Synonyms:DSCR5

Expression Region:1-134

Sequence Info:full length protein

View full details