Recombinant Pongo abelii  Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)

Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1(DAD1)

CSB-CF735780PYX
Regular price
$1,078.00 USD
Sale price
$1,078.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pongo abelii (Sumatran orangutan)

Uniprot NO.:Q5RBB4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVRLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Short name= Oligosaccharyl transferase subunit DAD1 EC= 2.4.1.119 Alternative name(s): Defender against cell death 1 Short name= DAD

Gene Names:Name:DAD1

Expression Region:2-113

Sequence Info:full length protein

Your list is ready to share