
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: allergen
Uniprot ID: P35780
Gene Names: N/A
Organism: Polistes fuscatus (Paper wasp)
AA Sequence: VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK
Expression Region: 1-205aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 28.1 kDa
Alternative Name(s): Allergen Pol f V Antigen 5
Relevance:
Reference: "Allergens in Hymenoptera venom. XXV: the amino acid sequences of antigen 5 molecules and the structural basis of antigenic cross-reactivity." Hoffman D.R. J. Allergy Clin. Immunol. 92:707-716(1993)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.