Gene Bio Systems
Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066(Bpro_0066)
Recombinant Polaromonas sp. UPF0391 membrane protein Bpro_0066(Bpro_0066)
SKU:CSB-CF619670PAAI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Polaromonas sp. (strain JS666 / ATCC BAA-500)
Uniprot NO.:Q12HF9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKYAIIFAVISLIAGALGFGGVAAGAAGIAKILFGLFLILAVIFVVLAALGVGAVRKGM K
Protein Names:Recommended name: UPF0391 membrane protein Bpro_0066
Gene Names:Ordered Locus Names:Bpro_0066
Expression Region:1-61
Sequence Info:full length protein
