Skip to product information
1 of 1

Gene Bio Systems

Recombinant Platanus acerifolia Putative invertase inhibitor

Recombinant Platanus acerifolia Putative invertase inhibitor

SKU:CSB-YP818103PGAT

Regular price $1,363.00 USD
Regular price Sale price $1,363.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Allergen

Uniprot ID: Q8GT41

Gene Names: N/A

Organism: London plane tree

AA Sequence: ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA

Expression Region: 24-179aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 18.6 kDa

Alternative Name(s): Pollen allergen Pla a 1 Allergen: Pla a 1

Relevance: Invertase inhibitor.

Reference: "The major Platanus acerifolia pollen allergen Pla a 1 has sequence homology to invertase inhibitors."Asturias J.A., Ibarrola I., Eraso E., Arilla M.C., Martinez A.Clin. Exp. Allergy 33:978-985(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details