Gene Bio Systems
Recombinant Pisum sativum Inner membrane protein PPF-1, chloroplastic(PPF-1)
Recombinant Pisum sativum Inner membrane protein PPF-1, chloroplastic(PPF-1)
SKU:CSB-CF875555EWE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pisum sativum (Garden pea)
Uniprot NO.:Q9FY06
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKTLISSPSFLGTPLPSLHRTFSPNRTRLFTKVQFSFHQLPPIQSVSHSVDLSGIFARA EGLLYTLADATVAADAAASTDVAAQKNGGWFGFISDGMEFVLKVLKDG
Protein Names:Recommended name: Inner membrane protein PPF-1, chloroplastic Alternative name(s): Post-floral-specific protein 1
Gene Names:Name:PPF-1
Expression Region:1-108
Sequence Info:full length protein
