Recombinant Pig Zona pellucida sperm-binding protein 3(ZP3)

SKU: CSB-CF027121PI

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:P42098

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QPVWQDEGQRLRPSKPPTVMVECQEAQLVVIVSKDLFGTGKLIRPADLSLGPAKCEPLVSQDTDAVVRFEVGLHECGSSLQVTDDALVYSTFLRHDPRPAGNLSILRTNRAEVPIECHYPRQGNVSSWAILPTWVPFRTTVFSEEKLVFSLRLMEENWSAEKMTPTFQLGDRAHLQAQVHTGSHVPLRLFVDHCVATLTPDWNTSPSHTIVDFHGCLVDGLTEASSAFKAPRPGPETLQFTVDVFHFANDSRNTIYITCHLKVTPADRVPDQLNKACSFSKSSNRWSPVEGPAVICRCCHKGQCGTPSLSRKLSMPKRQSAPRSRRHVTDEA

Protein Names:Recommended name: Zona pellucida sperm-binding protein 3 Alternative name(s): Sperm receptor Zona pellucida glycoprotein 3 Short name= Zp-3 Zona pellucida glycoprotein 3-beta Short name= Zp-3-beta Short name= Zp3-beta Zona pellucida protein C Cleaved into the following chain: 1. Processed zona pellucida sperm-binding protein 3

Gene Names:Name:ZP3 Synonyms:ZP3B, ZPC

Expression Region:23-332

Sequence Info:full length protein