Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

CSB-CF020909PI
Regular price
$1,105.00 USD
Sale price
$1,105.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:A5GZW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DRHTPGWCGVQHIHLSPSHQASSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLA AALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAML WKL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): CII-4 QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cyto

Gene Names:Name:SDHD

Expression Region:37-159

Sequence Info:Full length protein