Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(SDHC)

Recombinant Pig Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(SDHC)

SKU:CSB-CF020908PI

Regular price $1,729.00 USD
Regular price Sale price $1,729.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:D0VWV4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSA LLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLT QSGVVVLILTVLSSVGLAAM

Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Succinate-ubiquinone oxidoreductase cytochrome B large subunit Short name= CYBL

Gene Names:Name:SDHC

Expression Region:30-169

Sequence Info:Full length protein

View full details