Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Somatotropin(GH1)

Recombinant Pig Somatotropin(GH1)

SKU:CSB-EP009407PI(A4)

Regular price $599.00 USD
Regular price Sale price $599.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Developmental Biology

Uniprot ID:P01248

Gene Names:GH1

Organism:Sus scrofa (Pig)

AA Sequence:MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Expression Region:1-216aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:29.4 kDa

Alternative Name(s):Growth hormone

Relevance:Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Reference:"Porcine growth hormone: molecular cloning of cDNA and expression in bacterial and mammalian cells." Kato Y., Shimokawa N., Kato T., Hirai T., Yoshihama K., Kawai H., Hattori M.A., Ezashi T., Shimogori Y., Wakabayashi K. Biochim. Biophys. Acta 1048:290-293(1990)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Somatotropin/prolactin family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Ssc&CID=10492

KEGG Database Link:

STRING Database Link:https://string-db.org/network/9823.ENSSSCP00000018314

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details