Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Sarcoplasmic-endoplasmic reticulum calcium ATPase 3(ATP2A3)

Recombinant Pig Sarcoplasmic-endoplasmic reticulum calcium ATPase 3(ATP2A3)

SKU:CSB-CF002334PI

Regular price $1,722.00 USD
Regular price Sale price $1,722.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O77696

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGW LFFRYLAIGVYVGLATVAAATWWFLYDAEGPQVTFHQLRNFLKCSEDNPLFAGIDCEVFE SRFPTTMALSVLVTI

Protein Names:Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name= SERCA3 Short name= SR Ca(2+)-ATPase 3 EC= 3.6.3.8 Alternative name(s): Calcium pump 3

Gene Names:Name:ATP2A3

Expression Region:1-135

Sequence Info:Full length protein

View full details