Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)

Recombinant Pig Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)

CSB-CF871323PI
Regular price
$1,083.00 USD
Sale price
$1,083.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q9TTJ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHR QELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADALWWGVVTVTTIGYGDKV PQT

Protein Names:Recommended name: Potassium voltage-gated channel subfamily KQT member 1 Alternative name(s): IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1

Gene Names:Name:KCNQ1 Synonyms:KVLQT1

Expression Region:1-123

Sequence Info:full length protein