Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Interleukin-2 receptor subunit alpha(IL2RA)

Recombinant Pig Interleukin-2 receptor subunit alpha(IL2RA)

SKU:CSB-CF011649PI

Regular price $1,920.00 USD
Regular price Sale price $1,920.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:O02733

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQLAVAGCVLLLLSILLLSGLTWQRRR

Protein Names:Recommended name: Interleukin-2 receptor subunit alpha Short name= IL-2 receptor subunit alpha Short name= IL-2-RA Short name= IL-2R subunit alpha Short name= IL2-RA Alternative name(s): CD_antigen= CD25

Gene Names:Name:IL2RA

Expression Region:22-270

Sequence Info:full length protein

View full details