Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Heat shock protein HSP 90-alpha(HSP90AA1),partial

Recombinant Pig Heat shock protein HSP 90-alpha(HSP90AA1),partial

SKU:CSB-BP010802PI

Regular price $684.00 USD
Regular price Sale price $684.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Signal Transduction

Uniprot ID: O02705

Gene Names: HSP90AA1

Organism: Sus scrofa (Pig)

AA Sequence: VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR

Expression Region: 222-367aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

MW: 19.7 kDa

Alternative Name(s):

Relevance: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (By similarity). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion (By similarity).

Reference: "Molecular cloning and characterization of porcine cDNA encoding a 90-KDA heat shock protein and its expression following hyperthermia." Huang H.W., Lee W.C., Lin J.H., Jian S.C., Mao S.J., Yang P.C., Huang T.Y., Liu Y.C.Gene 226:307-315(1999) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details