Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Glycophorin-A(GYPA)

Recombinant Pig Glycophorin-A(GYPA)

SKU:CSB-CF010074PI

Regular price $1,771.00 USD
Regular price Sale price $1,771.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:P02725

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TETPVTGEQGSATPGNVSNATVTAGKPSATSPGVMTIKNTTAVVQKETGVPESYHQDFSHAEITGIIFAVMAGLLLIIFLIAYLIRRMIKKPLPVPKPQDSPDIGTENTADPSELQDTEDPPLTSVEIETPAS

Protein Names:Recommended name: Glycophorin-A Alternative name(s): CD_antigen= CD235a

Gene Names:Name:GYPA

Expression Region:1-133

Sequence Info:full length protein

View full details