Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Delta-type opioid receptor(OPRD1)

Recombinant Pig Delta-type opioid receptor(OPRD1)

SKU:CSB-CF016358PI

Regular price $1,837.00 USD
Regular price Sale price $1,837.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:P79291

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL

Protein Names:Recommended name: Delta-type opioid receptor Short name= D-OR-1 Short name= DOR-1

Gene Names:Name:OPRD1

Expression Region:1-228

Sequence Info:Full length protein

View full details