Recombinant Pig Chloride intracellular channel protein 1(CLIC1)

Recombinant Pig Chloride intracellular channel protein 1(CLIC1)

CSB-CF643671PI
Regular price
$1,072.00 USD
Sale price
$1,072.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q29238

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPG GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDI

Protein Names:Recommended name: Chloride intracellular channel protein 1 Alternative name(s): Nuclear chloride ion channel 27

Gene Names:Name:CLIC1

Expression Region:2-110

Sequence Info:full length protein