Recombinant Pig Antibacterial peptide PMAP-36(PMAP36)

SKU: CSB-EP344230PI

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P49931

Gene Names: PMAP36

Organism: Sus scrofa (Pig)

AA Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

Expression Region: 130-166aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 20.3 kDa

Alternative Name(s): Myeloid antibacterial peptide 36

Relevance: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Reference: "Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA."Storici P., Scocchi M., Tossi A., Gennaro R., Zanetti M.FEBS Lett. 337:303-307(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.