Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pig Adipogenin(ADIG)

Recombinant Pig Adipogenin(ADIG)

SKU:CSB-CF001365PI

Regular price $1,691.00 USD
Regular price Sale price $1,691.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q30C86

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYPLVPLVNELTFSFLASWLCLPVGLLLFLLIVWLRFLLSQDSEENDSDLCFDWEPWSK GPAEFCQEETLHSPEEERPCW

Protein Names:Recommended name: Adipogenin Alternative name(s): Small adipocyte factor 1 Short name= SMAF-1

Gene Names:Name:ADIG Synonyms:SMAF1

Expression Region:1-81

Sequence Info:full length protein

View full details