Skip to product information
1 of 1

Gene Bio Systems

Recombinant Picrophilus torridus UPF0290 protein PTO1104(PTO1104)

Recombinant Picrophilus torridus UPF0290 protein PTO1104(PTO1104)

SKU:CSB-CF764310PAAB

Regular price $1,786.00 USD
Regular price Sale price $1,786.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)

Uniprot NO.:Q6L013

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNIIMVLYSIFLFLPAFIANPGAVITGGHFILDRGKTIHGKRILGDGKSLSGFIGGSLI GVLAGIIVYYIIYISNIGLGNYGNNIISALPVLFAMSFGSLTGDITGSFIKRRLGMKRGA KGSLLDQWPFVLMSFLFIFIFARHFFLEFYGNFIAIILILVLTPPLHRGVNILGYKLKMK DVPW

Protein Names:Recommended name: UPF0290 protein PTO1104

Gene Names:Ordered Locus Names:PTO1104

Expression Region:1-184

Sequence Info:full length protein

View full details